RASL10A (NM_006477) Human Mass Spec Standard
CAT#: PH305271
RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_006468)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205271 |
Predicted MW | 22.5 kDa |
Protein Sequence |
>RC205271 protein sequence
Red=Cloning site Green=Tags(s) MGGSLRVAVLGAPGVGKTAIIRQFVFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPG GPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGP RRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006468 |
RefSeq Size | 1504 |
RefSeq ORF | 609 |
Synonyms | RRP22 |
Locus ID | 10633 |
UniProt ID | Q92737, A0A024R1C8 |
Cytogenetics | 22q12.2 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416619 | RASL10A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423485 | RASL10A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416619 | Transient overexpression lysate of RAS-like, family 10, member A (RASL10A), transcript variant 1 |
USD 396.00 |
|
LY423485 | Transient overexpression lysate of RAS-like, family 10, member A (RASL10A), transcript variant 2 |
USD 396.00 |
|
PH308743 | RASL10A MS Standard C13 and N15-labeled recombinant protein (NP_001007280) |
USD 2,055.00 |
|
TP305271 | Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 1 |
USD 823.00 |
|
TP308743 | Recombinant protein of human RAS-like, family 10, member A (RASL10A), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review