GEM (NM_181702) Human Mass Spec Standard

CAT#: PH305286

GEM MS Standard C13 and N15-labeled recombinant protein (NP_859053)

Product Images

Coomassie blue staining of purified GEM protein (Cat# TP305286). The protein was produced from HEK293T cells transfected with GEM cDNA clone (Cat# RC205286) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205286
• Predicted MW: 33.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205286 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSE
  SGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENE
  WLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACA
  VVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKN
  MAFKLKSKSCHDLSVL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_859053
• RefSeq Size: 2080
• RefSeq ORF: 888
• Synonyms: KIR
• Locus ID: 2669
• UniProt ID: P55040, A0A024R9F5
• Cytogenetics: 8q22.1
• Summary: 'The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome