Calreticulin 3 (CALR3) (NM_145046) Human Mass Spec Standard

CAT#: PH305398

CALR3 MS Standard C13 and N15-labeled recombinant protein (NP_659483)

Product Images

Coomassie blue staining of purified CALR3 protein (Cat# TP305398). The protein was produced from HEK293T cells transfected with CALR3 cDNA clone (Cat# RC205398) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205398
• Predicted MW: 45 kDa
• Protein Sequence:
  Sequence Link

  >RC205398 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARALVQFWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQ
  NGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFD
  IKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETS
  PAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKM
  KNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKE
  EMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_659483
• RefSeq Size: 1295
• RefSeq ORF: 1152
• Synonyms: CMH19; CRT2; CT93
• Locus ID: 125972
• UniProt ID: Q96L12, A0A140VJF7
• Cytogenetics: 19p13.11
• Summary: The protein encoded by this gene belongs to the calreticulin family, members of which are calcium-binding chaperones localized mainly in the endoplasmic reticulum. This protein is also localized to the endoplasmic reticulum lumen, however, its capacity for calcium-binding may be absent or much lower than other family members. This gene is specifically expressed in the testis, and may be required for sperm fertility. Mutation in this gene has been associated with familial hypertrophic cardiomyopathy. [provided by RefSeq, Dec 2011]