GAS2 (NM_177553) Human Mass Spec Standard
CAT#: PH305912
GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_808221)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205912 |
Predicted MW | 34.9 kDa |
Protein Sequence |
>RC205912 protein sequence
Red=Cloning site Green=Tags(s) MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHK QPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRIS EDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGK TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_808221 |
RefSeq Size | 2182 |
RefSeq ORF | 939 |
Synonyms | GAS-2 |
Locus ID | 2620 |
UniProt ID | O43903 |
Cytogenetics | 11p14.3 |
Summary | 'The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2017]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406084 | GAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417420 | GAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428373 | GAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429249 | GAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406084 | Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 2 |
USD 396.00 |
|
LY417420 | Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 1 |
USD 396.00 |
|
LY428373 | Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 3 |
USD 396.00 |
|
LY429249 | Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 1 |
USD 396.00 |
|
PH323624 | GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_005247) |
USD 2,055.00 |
|
PH326863 | GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001137302) |
USD 2,055.00 |
|
TP305912 | Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 2 |
USD 823.00 |
|
TP323624 | Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 1 |
USD 748.00 |
|
TP326863 | Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review