SMRP1 (C9orf24) (NM_032596) Human Mass Spec Standard
CAT#: PH305959
C9orf24 MS Standard C13 and N15-labeled recombinant protein (NP_115985)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205959 |
Predicted MW | 30.2 kDa |
Protein Sequence |
>RC205959 protein sequence
Red=Cloning site Green=Tags(s) MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHTMERHVDPEALQKMAKCAVQD YTYRGSISGHPYLPEKYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCCNKYTTYLPRLPKEARMETAV RGMPLECPPRPERLNAYEREVMVNMLNSLSRNQQLPRITPRCGCVDPLPGRLPFHGYESACSGRHYCLRG MDYYASGAPCTDRRLRPWCREQQTMCTSLRAPARNAVCCYNSPAVILPISEP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115985 |
RefSeq Size | 1184 |
RefSeq ORF | 786 |
Synonyms | bA573M23.4; CBE1; NYD-SP22; SMRP1 |
Locus ID | 84688 |
UniProt ID | Q8NCR6 |
Cytogenetics | 9p13.3 |
Summary | This gene encodes a nuclear- or perinuclear-localized protein with no predicted domains or similarity to other known proteins. Expression of this gene is induced during the differentiation of bronchial epithelial cells, and the encoded protein may play a role in ciliogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410011 | C9orf24 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410011 | Transient overexpression lysate of chromosome 9 open reading frame 24 (C9orf24), transcript variant 1 |
USD 396.00 |
|
TP305959 | Recombinant protein of human chromosome 9 open reading frame 24 (C9orf24), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review