PMP2 (NM_002677) Human Mass Spec Standard
CAT#: PH306053
PMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002668)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206053 |
Predicted MW | 14.9 kDa |
Protein Sequence |
>RC206053 protein sequence
Red=Cloning site Green=Tags(s) MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQE FEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002668 |
RefSeq Size | 3579 |
RefSeq ORF | 396 |
Synonyms | CMT1G; FABP8; M-FABP; MP2; P2 |
Locus ID | 5375 |
UniProt ID | P02689 |
Cytogenetics | 8q21.13 |
Summary | 'The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy. [provided by RefSeq, Jan 2017]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400948 | PMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400948 | Transient overexpression lysate of peripheral myelin protein 2 (PMP2) |
USD 396.00 |
|
TP306053 | Recombinant protein of human peripheral myelin protein 2 (PMP2) |
USD 823.00 |
|
TP720618 | Purified recombinant protein of Human peripheral myelin protein 2 (PMP2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review