KCTD17 (NM_024681) Human Mass Spec Standard
CAT#: PH306070
KCTD17 MS Standard C13 and N15-labeled recombinant protein (NP_078957)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206070 |
Predicted MW | 32.5 kDa |
Protein Sequence |
>RC206070 protein sequence
Red=Cloning site Green=Tags(s) MRMEAGEAAPPAGAGGRAAGGWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRLCQGEELQSDRDETGAYL IDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTVTQVPPKHVYRVL QCQEEELTQMVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQL EEQQQQEEEVEEVEVEQVQVEADAQEKGSRPHPLRPEAELAVRASPRPLARPQSCHPCCYKPEAPGCEAP DHLQGLGVPI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_078957 |
RefSeq Size | 1707 |
RefSeq ORF | 870 |
Synonyms | FLJ12242; FLJ98761 |
Locus ID | 79734 |
UniProt ID | Q8N5Z5 |
Cytogenetics | 22q12.3 |
Summary | This gene encodes a protein that belongs to a conserved family of potassium channel tetramerization domain (KCTD)-containing proteins. The encoded protein functions in ciliogenesis by acting as a substrate adaptor for the cullin3-based ubiquitin-conjugating enzyme E3 ligase, and targets trichoplein, a keratin-binding protein, for degradation via polyubiquitinylation. A mutation in this gene is associated with autosomal dominant myoclonic dystonia 26. [provided by RefSeq, Nov 2016] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411141 | KCTD17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411141 | Transient overexpression lysate of potassium channel tetramerisation domain containing 17 (KCTD17) |
USD 396.00 |
|
TP306070 | Recombinant protein of human potassium channel tetramerisation domain containing 17 (KCTD17) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review