Probable hydrolase PNKD (PNKD) (NM_015488) Human Mass Spec Standard

CAT#: PH306179

PNKD MS Standard C13 and N15-labeled recombinant protein (NP_056303)

Product Images

Coomassie blue staining of purified PNKD protein (Cat# TP306179). The protein was produced from HEK293T cells transfected with PNKD cDNA clone (Cat# RC206179) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206179
• Predicted MW: 42.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206179 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVVAATALKSRGARNARVLRGILAGATANKVSHNRTRALQSHSSSEGKEEPEPLSPELEYIPRKRGKN
  PMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQA
  QLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCH
  QDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLG
  LGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLAL
  QEALGPGPGPTGDDDYSRAQLLEELRRLKDMHKSK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056303
• RefSeq Size: 3129
• RefSeq ORF: 1155
• Synonyms: BRP17; DYT8; FKSG19; FPD1; KIPP1184; MR-1; MR-1S; MR1; PDC; PKND1; PNKD1; TAHCCP2
• Locus ID: 25953
• UniProt ID: Q8N490, A0A024R415
• Cytogenetics: 2q35
• Summary: This gene is thought to play a role in the regulation of myofibrillogenesis. Mutations in this gene have been associated with the movement disorder paroxysmal non-kinesigenic dyskinesia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
• Protein Families: Transmembrane