EIF5 (NM_001969) Human Mass Spec Standard
CAT#: PH306301
EIF5 MS Standard C13 and N15-labeled recombinant protein (NP_001960)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206301 |
Predicted MW | 49.2 kDa |
Protein Sequence |
>RC206301 protein sequence
Red=Cloning site Green=Tags(s) MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF ILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEE AQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVL TEVLFNEKIREQIKKYRRHFLRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEV IISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSD NKDDDIDIDAI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001960 |
RefSeq Size | 5963 |
RefSeq ORF | 1293 |
Synonyms | EIF-5; EIF-5A |
Locus ID | 1983 |
UniProt ID | P55010, A0A024R6Q1 |
Cytogenetics | 14q32.32 |
Summary | 'Eukaryotic translation initiation factor-5 (EIF5) interacts with the 40S initiation complex to promote hydrolysis of bound GTP with concomitant joining of the 60S ribosomal subunit to the 40S initiation complex. The resulting functional 80S ribosomal initiation complex is then active in peptidyl transfer and chain elongations (summary by Si et al., 1996 [PubMed 8663286]).[supplied by OMIM, May 2010]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405302 | EIF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419615 | EIF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430639 | EIF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405302 | Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 2 |
USD 396.00 |
|
LY419615 | Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 1 |
USD 396.00 |
|
LY430639 | Transient overexpression lysate of eukaryotic translation initiation factor 5 (EIF5), transcript variant 2 |
USD 396.00 |
|
TP306301 | Recombinant protein of human eukaryotic translation initiation factor 5 (EIF5), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review