Pancreatic Polypeptide (PPY) (NM_002722) Human Mass Spec Standard
CAT#: PH306584
PPY MS Standard C13 and N15-labeled recombinant protein (NP_002713)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206584 |
| Predicted MW | 10.4 kDa |
| Protein Sequence |
>RC206584 protein sequence
Red=Cloning site Green=Tags(s) MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHK EDTLAFSEWGSPHAAVPRELSPLDL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002713 |
| RefSeq Size | 457 |
| RefSeq ORF | 285 |
| Synonyms | PNP; PP |
| Locus ID | 5539 |
| UniProt ID | P01298 |
| Cytogenetics | 17q21.31 |
| Summary | 'This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded 95 aa preproprotein is synthesized in the pancreatic islets of Langerhans and proteolytically processed to generate two peptide products. These products include the active pancreatic hormone of 36 aa and an icosapeptide of unknown function. This hormone acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake. Plasma level of this hormone has been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa. In addition, infusion of this hormone in obese rodents has shown to decrease weight gain. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]' |
| Protein Families | Secreted Protein |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP306584 | Purified recombinant protein of Homo sapiens pancreatic polypeptide (PPY) |
USD 823.00 |
|
| TP721220 | Purified recombinant protein of Human pancreatic polypeptide (PPY) |
USD 330.00 |
|
| TP762154 | Purified recombinant protein of Human pancreatic polypeptide (PPY),Ala30-Arg88, N-terminal His-PDCD1(Pro21-Val170) tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China