LYNX1-SLURP2 (NM_023946) Human Mass Spec Standard

CAT#: PH307126

LYNX1 MS Standard C13 and N15-labeled recombinant protein (NP_076435)

Product Images

Coomassie blue staining of purified LYNX1-SLURP2 protein (Cat# TP307126). The protein was produced from HEK293T cells transfected with LYNX1-SLURP2 cDNA clone (Cat# RC207126) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207126
• Predicted MW: 13.8 kDa
• Protein Sequence:
  Sequence Link

  >RC207126 representing NM_023946
  Red=Cloning site Green=Tags(s)
  
  MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSH
  GSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076435
• RefSeq Size: 1352
• RefSeq ORF: 393
• Synonyms: SLURP2
• Locus ID: 111188157
• UniProt ID: P0DP58
• Summary: This locus represents naturally occurring read-through transcription between the neighboring LYNX1 and SLURP2 genes. The readthrough transcript encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The significance of this read-through transcription and the function of the resulting protein product have not yet been determined. [provided by RefSeq, Sep 2017]