Mimitin (NDUFAF2) (NM_174889) Human Mass Spec Standard

CAT#: PH307387

NDUFAF2 MS Standard C13 and N15-labeled recombinant protein (NP_777549)

Product Images

Coomassie blue staining of purified NDUFAF2 protein (Cat# TP307387). The protein was produced from HEK293T cells transfected with NDUFAF2 cDNA clone (Cat# RC207387) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207387
• Predicted MW: 19.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207387 representing NM_174889
  Red=Cloning site Green=Tags(s)
  
  MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTE
  WEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGK
  EEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_777549
• RefSeq Size: 650
• RefSeq ORF: 507
• Synonyms: B17.2L; MC1DN10; mimitin; MMTN; NDUFA12L
• Locus ID: 91942
• UniProt ID: Q8N183, A0A0S2Z5U1
• Cytogenetics: 5q12.1
• Summary: NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency. [provided by RefSeq, Jul 2008]