MAST4 (NM_198828) Human Mass Spec Standard

CAT#: PH307706

MAST4 MS Standard C13 and N15-labeled recombinant protein (NP_942123)

Product Images

Coomassie blue staining of purified MAST4 protein (Cat# TP307706). The protein was produced from HEK293T cells transfected with MAST4 cDNA clone (Cat# RC207706) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207706
• Predicted MW: 25.5 kDa
• Protein Sequence:
  Sequence Link

  >RC207706 representing NM_198828
  Red=Cloning site Green=Tags(s)
  
  MGEKVSEAPEPVPRGCSGHGSRTPASALVAASSPGASSAESSSGSETLSEEGEPGGFSREHQPPPPPPLG
  GTLGARAPAAWAPASVLLERGVLALPPPLPGGAVPPAPRGSSASQEEQDEELDHILSPPPMPFRKCSNPD
  VASGPGKSLKYKRQLSEDGRQLRRGSLGGALTGRYLLPNPVAGQAWPASAETSNLVRMRSQALGQSAPSL
  TASLKELSLPRRGSLIDSQKWNCLVKRPVCPNAGRTSPLG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_942123
• RefSeq Size: 1105
• RefSeq ORF: 750
• Synonyms: DKFZp686E18148; DKFZp686N1467; FLJ16540; FLJ33039; KIAA0303
• Locus ID: 375449
• UniProt ID: O15021
• Cytogenetics: 5q12.3
• Summary: This gene encodes a member of the microtubule-associated serine/threonine protein kinases. The proteins in this family contain a domain that gives the kinase the ability to determine its own scaffold to control the effects of their kinase activities. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]
• Protein Families: Druggable Genome, Protein Kinase