Calcipressin 3 (RCAN3) (NM_013441) Human Mass Spec Standard

CAT#: PH307755

RCAN3 MS Standard C13 and N15-labeled recombinant protein (NP_038469)

Product Images

Coomassie blue staining of purified RCAN3 protein (Cat# TP307755). The protein was produced from HEK293T cells transfected with RCAN3 cDNA clone (Cat# RC207755) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207755
• Predicted MW: 27.5 kDa
• Protein Sequence:
  Sequence Link

  >RC207755 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEA
  LFTIYDDQVTFQLFKSFRRVRINFSKPEAAARARIELHETDFNGQKLKLYFAQVQMSGEVRDKSYLLPPQ
  PVKQFLISPPASPPVGWKQSEDAMPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEE
  TKNPKQKIAQTRRPDPPTAALNEPQTFDCAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_038469
• RefSeq Size: 2787
• RefSeq ORF: 723
• Synonyms: DSCR1L2; hRCN3; MCIP3; RCN3
• Locus ID: 11123
• UniProt ID: Q9UKA8, A0A024RAH2
• Cytogenetics: 1p36.11
• Summary: Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development. [UniProtKB/Swiss-Prot Function]