Nurim (NRM) (NM_007243) Human Mass Spec Standard

CAT#: PH308090

NRM MS Standard C13 and N15-labeled recombinant protein (NP_009174)

Product Images

Coomassie blue staining of purified NRM protein (Cat# TP308090). The protein was produced from HEK293T cells transfected with NRM cDNA clone (Cat# RC208090) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208090
• Predicted MW: 29.4 kDa
• Protein Sequence:
  Sequence Link

  >RC208090 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLL
  LLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIPKGPVLWEARAEPWATWVPLL
  CFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEPLALKSPRALRLFSHLRHPVCVELLTVLWVV
  PTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLLSRPQDGEAE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009174
• RefSeq Size: 1767
• RefSeq ORF: 786
• Synonyms: NRM29
• Locus ID: 11270
• UniProt ID: Q8IXM6, A0A1U9X845, B3KQU6
• Cytogenetics: 6p21.33
• Summary: The protein encoded by this gene contains transmembrane domains and resides within the inner nuclear membrane, where it is tightly associated with the nucleus. This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]
• Protein Families: Transmembrane