PI 4 Kinase type 2 beta (PI4K2B) (NM_018323) Human Mass Spec Standard

CAT#: PH308238

PI4K2B MS Standard C13 and N15-labeled recombinant protein (NP_060793)

Product Images

Coomassie blue staining of purified PI4K2B protein (Cat# TP308238). The protein was produced from HEK293T cells transfected with PI4K2B cDNA clone (Cat# RC208238) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208238
• Predicted MW: 54.8 kDa
• Protein Sequence:
  Sequence Link

  >RC208238 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEDPSEPDRLASADGGSPEEEEDGEREPLLPRIAWAHPRRGAPGSAVRLLDAAGEEGEAGDEELPLPPGD
  VGVSRSSPAELDRSRPAVSVTIGTSEMNAFLDDPEFADIMLRAEQAIEVGIFPERISQGSSGSYFVKDPK
  RKIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGAYLVDNKLHLSIVPKTKVV
  WLVSETFNYNAIDRAKSRGKKYALEKVPKVGRKFHRIGLPPKIGSFQLFVEGYKEAEYWLRKFEADPLPE
  NIRKQFQSQFERLVILDYIIRNTDRGNDNWLVRYEKQKCEKEIDHKESKWIDDEEFLIKIAAIDNGLAFP
  FKHPDEWRAYPFHWAWLPQAKVPFSEEIRNLILPYISDMNFVQDLCEDLYELFKTDKGFDKATFESQMSV
  MRGQILNLTQALRDGKSPFQLVQIPCVIVERSQGGSQGRIVHLSNSFTQTVNCRKPFFSSW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060793
• RefSeq Size: 3601
• RefSeq ORF: 1443
• Synonyms: PI4KIIB; PIK42B
• Locus ID: 55300
• UniProt ID: Q8TCG2
• Cytogenetics: 4p15.2
• Summary: This gene encodes a member of the type II PI4 kinase protein family. The encoded protein is primarily cytosolic and contributes to overall PI4-kinase activity along with other protein family members. This protein is involved in early T cell activation. [provided by RefSeq, Dec 2016]
• Protein Families: Druggable Genome