COA5 (NM_001008215) Human Mass Spec Standard

CAT#: PH308299

C2orf64 MS Standard C13 and N15-labeled recombinant protein (NP_001008216)

Product Images

Coomassie blue staining of purified COA5 protein (Cat# TP308299). The protein was produced from HEK293T cells transfected with COA5 cDNA clone (Cat# RC208299) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208299
• Predicted MW: 8.4 kDa
• Protein Sequence:
  Sequence Link

  >RC208299 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRG
  RKGY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001008216
• RefSeq Size: 1767
• RefSeq ORF: 222
• Synonyms: 6330578E17Rik; C2orf64; CEMCOX3; Pet191
• Locus ID: 493753
• UniProt ID: Q86WW8
• Cytogenetics: 2q11.2
• Summary: This gene encodes an ortholog of yeast Pet191, which in yeast is a subunit of a large oligomeric complex associated with the mitochondrial inner membrane, and required for the assembly of the cytochrome c oxidase complex. Mutations in this gene are associated with mitochondrial complex IV deficiency, a disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to a severe disease affecting several tissues and organs. [provided by RefSeq, Dec 2011]