Fetuin A (AHSG) (NM_001622) Human Mass Spec Standard

CAT#: PH308344

AHSG MS Standard C13 and N15-labeled recombinant protein (NP_001613)

Product Images

Coomassie blue staining of purified AHSG protein (Cat# TP308344). The protein was produced from HEK293T cells transfected with AHSG cDNA clone (Cat# RC208344) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208344
• Predicted MW: 39.3 kDa
• Protein Sequence:
  Sequence Link

  >RC208344 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWP
  QQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAE
  DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVA
  KEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPS
  PPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA
  AGPVVPPCPGRIRHFKV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001613
• RefSeq Size: 1594
• RefSeq ORF: 1101
• Synonyms: A2HS; AHS; APMR1; FETUA; HSGA
• Locus ID: 197
• UniProt ID: P02765
• Cytogenetics: 3q27.3
• Summary: 'The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. [provided by RefSeq, Aug 2017]'
• Protein Families: Druggable Genome, Secreted Protein