DGCR6 (NM_005675) Human Mass Spec Standard

CAT#: PH308368

DGCR6 MS Standard C13 and N15-labeled recombinant protein (NP_005666)

Product Images

Coomassie blue staining of purified DGCR6 protein (Cat# TP308368). The protein was produced from HEK293T cells transfected with DGCR6 cDNA clone (Cat# RC208368) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208368
• Predicted MW: 24.8 kDa
• Protein Sequence:
  Sequence Link

  >RC208368 representing NM_005675
  Red=Cloning site Green=Tags(s)
  
  MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI
  QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQK
  IVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQ
  CDQKGSPVPP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005666
• RefSeq Size: 1188
• RefSeq ORF: 660
• Synonyms: DiGeorge syndrome critical region gene 6; DiGeorge syndrome critical region protein 6
• Locus ID: 8214
• UniProt ID: Q14129, X5D7D2
• Cytogenetics: 22q11
• Summary: DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. [provided by RefSeq, Nov 2008]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS