HHAT (NM_018194) Human Mass Spec Standard

CAT#: PH308447

HHAT MS Standard C13 and N15-labeled recombinant protein (NP_060664)

Product Images

Coomassie blue staining of purified HHAT protein (Cat# TP308447). The protein was produced from HEK293T cells transfected with HHAT cDNA clone (Cat# RC208447) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208447
• Predicted MW: 30.51 kDa
• Protein Sequence:
  Sequence Link

  >RC208447 representing NM_018194
  Red=Cloning site Green=Tags(s)
  
  MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEWGKQW
  LVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLHTTISFCVAQFRSQLLTWLCS
  LLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYYTSFSLELCWQQLPAASTSYSFPWMLAYVFY
  YPVLHNGPILSFSEFIKQMQQQEHDSLKASLCVLALGWAAFFAGGGWPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060664
• RefSeq Size: 3598
• RefSeq ORF: 2487
• Synonyms: MART2; SKI1; Skn
• Locus ID: 55733
• UniProt ID: Q5VTY9, B7Z5N1
• Cytogenetics: 1q32.2
• Summary: 'Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog' (see MIM 600725). [supplied by OMIM, Jul 2002]
• Protein Families: Transmembrane