EIF4EBP2 (NM_004096) Human Mass Spec Standard

CAT#: PH308664

EIF4EBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004087)

Product Images

Coomassie blue staining of purified EIF4EBP2 protein (Cat# TP308664). The protein was produced from HEK293T cells transfected with EIF4EBP2 cDNA clone (Cat# RC208664) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208664
• Predicted MW: 12.9 kDa
• Protein Sequence:
  Sequence Link

  >RC208664 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQT
  PPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004087
• RefSeq Size: 7531
• RefSeq ORF: 360
• Synonyms: 4EBP2; PHASII
• Locus ID: 1979
• UniProt ID: Q13542, A0A024QZM3
• Cytogenetics: 10q22.1
• Summary: 'This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq, Oct 2008]'
• Protein Families: Transcription Factors