DCUN1D4 (NM_015115) Human Mass Spec Standard

CAT#: PH308821

DCUN1D4 MS Standard C13 and N15-labeled recombinant protein (NP_055930)

Product Images

Coomassie blue staining of purified DCUN1D4 protein (Cat# TP308821). The protein was produced from HEK293T cells transfected with DCUN1D4 cDNA clone (Cat# RC208821) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208821
• Predicted MW: 30 kDa
• Protein Sequence:
  Sequence Link

  >RC208821 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MHSDAAAVNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPA
  SGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVV
  MLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFARQSKYK
  VINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKDKQMS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055930
• RefSeq Size: 4283
• RefSeq ORF: 771
• Synonyms: FLJ42355; KIAA0276
• Locus ID: 23142
• UniProt ID: Q92564
• Cytogenetics: 4q12