Methionine Sulfoxide Reductase A (MSRA) (NM_012331) Human Mass Spec Standard

CAT#: PH308916

MSRA MS Standard C13 and N15-labeled recombinant protein (NP_036463)

Product Images

Coomassie blue staining of purified MSRA protein (Cat# TP308916). The protein was produced from HEK293T cells transfected with MSRA cDNA clone (Cat# RC208916) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208916
• Predicted MW: 26.1 kDa
• Protein Sequence:
  Sequence Link

  >RC208916 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVF
  GMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWEN
  HDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQ
  YLSKNPNGYCGLGGTGVSCPVGIKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036463
• RefSeq Size: 1543
• RefSeq ORF: 705
• Synonyms: PMSR
• Locus ID: 4482
• UniProt ID: Q9UJ68
• Cytogenetics: 8p23.1
• Summary: This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]