CSDC2 (NM_014460) Human Mass Spec Standard
CAT#: PH308989
CSDC2 MS Standard C13 and N15-labeled recombinant protein (NP_055275)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208989 |
Predicted MW | 16.8 kDa |
Protein Sequence |
>RC208989 protein sequence
Red=Cloning site Green=Tags(s) MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFK GVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPH TPHETWSGQVVGS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055275 |
RefSeq Size | 2545 |
RefSeq ORF | 459 |
Synonyms | dJ347H13.2; PIPPIN |
Locus ID | 27254 |
UniProt ID | Q9Y534 |
Cytogenetics | 22q13.2 |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415263 | CSDC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415263 | Transient overexpression lysate of cold shock domain containing C2, RNA binding (CSDC2) |
USD 396.00 |
|
TP308989 | Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2) |
USD 823.00 |
|
TP710146 | Recombinant protein of human cold shock domain containing C2, RNA binding (CSDC2), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review