KAT5 (NM_006388) Human Mass Spec Standard

CAT#: PH309059

KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_006379)

Product Images

Coomassie blue staining of purified KAT5 protein (Cat# TP309059). The protein was produced from HEK293T cells transfected with KAT5 cDNA clone (Cat# RC209059) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209059
• Predicted MW: 58.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209059 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQF
  PKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCL
  QPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAP
  RMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHL
  TKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFH
  IVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
  TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLK
  RLLRIDSKCLHFTPKDWSKRGKW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006379
• RefSeq Size: 2248
• RefSeq ORF: 1539
• Synonyms: cPLA2; ESA1; HTATIP; HTATIP1; PLIP; TIP; TIP60; ZC2HC5
• Locus ID: 10524
• UniProt ID: Q92993, A0A024R597
• Cytogenetics: 11q13.1
• Summary: The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors