GNG2 (NM_053064) Human Mass Spec Standard

CAT#: PH309299

GNG2 MS Standard C13 and N15-labeled recombinant protein (NP_444292)

Product Images

Coomassie blue staining of purified GNG2 protein (Cat# TP309299). The protein was produced from HEK293T cells transfected with GNG2 cDNA clone (Cat# RC209299) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209299
• Predicted MW: 7.9 kDa
• Protein Sequence:
  Sequence Link

  >RC209299 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI
  L
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_444292
• RefSeq Size: 3903
• RefSeq ORF: 213
• Synonyms: G protein; guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit; guanine nucleotide binding protein (G protein), gamma 2; guanine nucleotide binding protein gamma 2
• Locus ID: 54331
• UniProt ID: P59768
• Cytogenetics: 14q22.1
• Summary: This gene encodes one of the gamma subunits of a guanine nucleotide-binding protein. Such proteins are involved in signaling mechanisms across membranes. Various subunits forms heterodimers which then interact with the different signal molecules. [provided by RefSeq, Aug 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway