SCOC (NM_032547) Human Mass Spec Standard

CAT#: PH309356

SCOC MS Standard C13 and N15-labeled recombinant protein (NP_115936)

Product Images

Coomassie blue staining of purified SCOC protein (Cat# TP309356). The protein was produced from HEK293T cells transfected with SCOC cDNA clone (Cat# RC209356) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209356
• Predicted MW: 13.9 kDa
• Protein Sequence:
  Sequence Link

  >RC209356 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGSRKEEEEDSTFTNISLADDIDHSSRILYPRPKSLLPKMMNADMDVDAENQVELEEKTRLINQVLELQ
  HTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115936
• RefSeq Size: 1974
• RefSeq ORF: 999
• Synonyms: HRIHFB2072; SCOCO; UNC-69
• Locus ID: 60592
• UniProt ID: Q9UIL1
• Cytogenetics: 4q31.1
• Summary: This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]