C10orf97 (FAM188A) (NM_024948) Human Mass Spec Standard

CAT#: PH309783

FAM188A MS Standard C13 and N15-labeled recombinant protein (NP_079224)

Product Images

Coomassie blue staining of purified MINDY3 protein (Cat# TP309783). The protein was produced from HEK293T cells transfected with MINDY3 cDNA clone (Cat# RC209783) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209783
• Predicted MW: 49.7 kDa
• Protein Sequence:
  Sequence Link

  >RC209783 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSE
  KSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALA
  VEELGFERFHALIQKRSFRSLPELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLID
  PVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIW
  IVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNK
  LDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTP
  IKRCLQTKWPYIELLWTTDRSPSLN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079224
• RefSeq Size: 2375
• RefSeq ORF: 1335
• Synonyms: C10orf97; CARP; DERP5; FAM188A; MST126; MSTP126; my042
• Locus ID: 80013
• UniProt ID: Q9H8M7
• Cytogenetics: 10p13
• Summary: The protein encoded by this gene contains a caspase-associated recruitment domain and may function in apoptosis. It has been identified as a tumor suppressor in lung and gastric cancers, and a polymorphism in the gene may be associated with gastric cancer risk. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome