NAPE PLD (NAPEPLD) (NM_198990) Human Mass Spec Standard
CAT#: PH309877
NAPEPLD MS Standard C13 and N15-labeled recombinant protein (NP_945341)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209877 |
Predicted MW | 45.6 kDa |
Protein Sequence |
>RC209877 protein sequence
Red=Cloning site Green=Tags(s) MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWP TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMD ELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWF VPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFF FAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALA NEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNNDENF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_945341 |
RefSeq Size | 5062 |
RefSeq ORF | 1179 |
Synonyms | C7orf18; FMP30; NAPE-PLD |
Locus ID | 222236 |
UniProt ID | Q6IQ20 |
Cytogenetics | 7q22.1 |
Summary | NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine (Okamoto et al., 2004 [PubMed 14634025]). [supplied by OMIM, Oct 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404703 | NAPEPLD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426574 | NAPEPLD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404703 | Transient overexpression lysate of N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 2 |
USD 396.00 |
|
LY426574 | Transient overexpression lysate of N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 1 |
USD 396.00 |
|
PH325603 | NAPEPLD MS Standard C13 and N15-labeled recombinant protein (NP_001116310) |
USD 2,055.00 |
|
TP309877 | Recombinant protein of human N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 2 |
USD 823.00 |
|
TP325603 | Recombinant protein of human N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review