gamma C Crystallin (CRYGC) (NM_020989) Human Mass Spec Standard

CAT#: PH310386

CRYGC MS Standard C13 and N15-labeled recombinant protein (NP_066269)

Product Images

Coomassie blue staining of purified CRYGC protein (Cat# TP310386). The protein was produced from HEK293T cells transfected with CRYGC cDNA clone (Cat# RC210386) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210386
• Predicted MW: 20.9 kDa
• Protein Sequence:
  Sequence Link

  >RC210386 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWM
  GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYR
  GRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066269
• RefSeq Size: 645
• RefSeq ORF: 522
• Synonyms: CCL; CRYG3; CTRCT2
• Locus ID: 1420
• UniProt ID: P07315, A0A0X8GLL6
• Cytogenetics: 2q33.3
• Summary: 'This gene encodes a member of the beta/gamma-crystallin family of proteins. Crystallins constitute the major proteins of vertebrate eye lens and maintain the transparency and refractive index of the lens. This gene and several family members are present in a gene cluster on chromosome 2. Mutations in this gene have been shown to cause multiple types of cataract, including Coppock-like cataract and zonular pulverulent cataract, among others. [provided by RefSeq, Jan 2015]'
• Protein Families: Druggable Genome