ASC2 (PYDC1) (NM_152901) Human Mass Spec Standard

CAT#: PH311240

PYDC1 MS Standard C13 and N15-labeled recombinant protein (NP_690865)

Product Images

Coomassie blue staining of purified PYDC1 protein (Cat# TP311240). The protein was produced from HEK293T cells transfected with PYDC1 cDNA clone (Cat# RC211240) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211240
• Predicted MW: 10.1 kDa
• Protein Sequence:
  Sequence Link

  >RC211240 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASYYEDYAAELVV
  AVLRDMRMLEEAARLQRAA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_690865
• RefSeq Size: 582
• RefSeq ORF: 267
• Synonyms: ASC2; cPOP1; POP1; PYC1
• Locus ID: 260434
• UniProt ID: Q8WXC3
• Cytogenetics: 16p11.2
• Summary: Associates with PYCARD/ASC and modulates its ability to collaborate with MEFV/pyrin and NLRP3/cryopyrin in NF-kappa-B and pro-caspase-1 activation. Suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS. [UniProtKB/Swiss-Prot Function]
• Protein Pathways: NOD-like receptor signaling pathway