NFKBIL1 (NM_005007) Human Mass Spec Standard

CAT#: PH311251

NFKBIL1 MS Standard C13 and N15-labeled recombinant protein (NP_004998)

Product Images

Coomassie blue staining of purified NFKBIL1 protein (Cat# TP311251). The protein was produced from HEK293T cells transfected with NFKBIL1 cDNA clone (Cat# RC211251) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211251
• Predicted MW: 43.2 kDa
• Protein Sequence:
  Sequence Link

  >RC211251 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQALLQRHPGLDVDAGQPPPLH
  RACARHDAPALCLLLRLGADPAHQDRHGDTALHAAARQGPDAYTDFFLPLLSRCPSAMGIKNKDGETPGQ
  ILGWGPPWDSAEEEEEDDASKEREWRQKLQGELEDEWQEVMGRFEGDASHETQEPESFSAWSDRLAREHA
  QKCQQQQREAEGSCRPPRAEGSSQSWRQQEEEQRLFRERARAKEEELRESRARRAQEALGDREPKPTRAG
  PREEHPRGAGRGSLWRFGDVPWPCPGGGDPEAMAAALVARGPPLEEQGALRRYLRVQQVRWHPDRFLQRF
  RSQIETWELGRVMGAVTALSQALNRHAEALK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004998
• RefSeq Size: 1510
• RefSeq ORF: 1143
• Synonyms: IKBL; NFKBIL
• Locus ID: 4795
• UniProt ID: Q9UBC1, A8K778
• Cytogenetics: 6p21.33
• Summary: 'This gene encodes a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009]'
• Protein Families: Transcription Factors