CHX10 (VSX2) (NM_182894) Human Mass Spec Standard

CAT#: PH312033

VSX2 MS Standard C13 and N15-labeled recombinant protein (NP_878314)

Product Images

Coomassie blue staining of purified VSX2 protein (Cat# TP312033). The protein was produced from HEK293T cells transfected with VSX2 cDNA clone (Cat# RC212033) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212033
• Predicted MW: 39.2 kDa
• Protein Sequence:
  Sequence Link

  >RC212033 representing NM_182894
  Red=Cloning site Green=Tags(s)
  
  MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSP
  AGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSAL
  NQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCW
  GRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKL
  DKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAE
  RLSPPQLEDMA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_878314
• RefSeq Size: 3005
• RefSeq ORF: 1083
• Synonyms: CHX10; HOX10; MCOP2; MCOPCB3; RET1
• Locus ID: 338917
• UniProt ID: P58304
• Cytogenetics: 14q24.3
• Summary: This gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in this gene are associated with microphthalmia, cataracts and iris abnormalities. [provided by RefSeq, Oct 2009]
• Protein Families: Transcription Factors