DNALI1 (NM_003462) Human Mass Spec Standard
CAT#: PH312111
DNALI1 MS Standard C13 and N15-labeled recombinant protein (NP_003453)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212111 |
Predicted MW | 31.7 kDa |
Protein Sequence |
>RC212111 representing NM_003462
Red=Cloning site Green=Tags(s) MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKARLLKVSPQQPGPSGSAPQPP KTKLPSTPCVPDPTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARET GICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQGKSD MERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003453 |
RefSeq Size | 2663 |
RefSeq ORF | 840 |
Synonyms | dJ423B22.5; hp28; P28 |
Locus ID | 7802 |
UniProt ID | O14645, A0A499FIY3 |
Cytogenetics | 1p34.3 |
Summary | This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. [provided by RefSeq, Jul 2008] |
Protein Pathways | Huntington's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418664 | DNALI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418664 | Transient overexpression lysate of dynein, axonemal, light intermediate chain 1 (DNALI1) |
USD 396.00 |
|
TP312111 | Recombinant protein of human dynein, axonemal, light intermediate chain 1 (DNALI1) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review