Lymphocyte Antigen 6 Complex (LY6K) (NM_017527) Human Mass Spec Standard

CAT#: PH312498

LY6K MS Standard C13 and N15-labeled recombinant protein (NP_059997)

Product Images

Coomassie blue staining of purified LY6K protein (Cat# TP312498). The protein was produced from HEK293T cells transfected with LY6K cDNA clone (Cat# RC212498) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212498
• Predicted MW: 25 kDa
• Protein Sequence:
  Sequence Link

  >RC212498 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLQRPRQAPAGGRRAPRGGRGSPYRPDPGRGARRLRRFQKGGEGAPRADPPWAPLGTMALLALLLVVAL
  PRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVA
  KQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAGSMGESCGGLWLAIL
  LLLASIAAGLSLS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_059997
• RefSeq Size: 1747
• RefSeq ORF: 669
• Synonyms: CT97; HSJ001348; ly-6K; URLC10
• Locus ID: 54742
• UniProt ID: Q17RY6
• Cytogenetics: 8q24.3
• Protein Families: Transmembrane