TBX10 (NM_005995) Human Mass Spec Standard

CAT#: PH312862

TBX10 MS Standard C13 and N15-labeled recombinant protein (NP_005986)

Product Images

Coomassie blue staining of purified TBX10 protein (Cat# TP312862). The protein was produced from HEK293T cells transfected with TBX10 cDNA clone (Cat# RC212862) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212862
• Predicted MW: 42.3 kDa
• Protein Sequence:
  Sequence Link

  >RC212862 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAFLSAGLGILAPSETYPLPTTSSGWEPRLGSPFPSGPCTSSTGAQAVAEPTGQGPKNPRVSRVTVQLE
  MKPLWEEFNQLGTEMIVTKAGRRMFPPFQVKILGMDSLADYALLMDFIPLDDKRYRYAFHSSAWLVAGKA
  DPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPRFHVVFVDPRKDSERY
  AQENFKSFIFTETQFTAVTAYQNHRITQLKIASNPFAKGFRESDLDSWPVAPRPLLSVPARSHSSLSPCV
  LKGATDREKDPNKASASTSKTPAWLHHQLLPPPEVLLAPATYRPVTYQSLYSGAPSHLGIPRTRPAPYPL
  PNIRADRDQGGLPLPAGLGLLSPTVVCLGPGQDSQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005986
• RefSeq Size: 1557
• RefSeq ORF: 1155
• Synonyms: TBX7; TBX13
• Locus ID: 347853
• UniProt ID: O75333
• Cytogenetics: 11q13.2
• Summary: This gene encodes a member of the T-box family of transcription factors. These transcription factors share a DNA-binding domain called the T-box, and play a role in several developmental processes including early embryonic cell fate and organogenesis. The encoded protein is a member of the T-box 1 subfamily. Mutations in this gene are thought to be a cause of isolated cleft lip with or without cleft palate. [provided by RefSeq, Nov 2010]