VTI1A (NM_145206) Human Mass Spec Standard

CAT#: PH313934

VTI1A MS Standard C13 and N15-labeled recombinant protein (NP_660207)

Product Images

Coomassie blue staining of purified VTI1A protein (Cat# TP313934). The protein was produced from HEK293T cells transfected with VTI1A cDNA clone (Cat# RC213934) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213934
• Predicted MW: 25 kDa
• Protein Sequence:
  Sequence Link

  >RC213934 representing NM_145206
  Red=Cloning site Green=Tags(s)
  
  MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMY
  SNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAV
  ETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAI
  TFSVRRH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660207
• RefSeq Size: 4401
• RefSeq ORF: 651
• Synonyms: MMDS3; MVti1; Vti1-rp2; VTI1RP2
• Locus ID: 143187
• UniProt ID: Q96AJ9
• Cytogenetics: 10q25.2
• Summary: The protein encoded by this gene is a member of the family of soluble N-ethylmaleimide-sensitive fusion protein-attachment protein receptors (SNAREs) that function in intracellular trafficking. This family member is involved in vesicular transport between endosomes and the trans-Golgi network. It is a vesicle-associated SNARE (v-SNARE) that interacts with target membrane SNAREs (t-SNAREs). Polymorphisms in this gene have been associated with binocular function, and also with susceptibility to colorectal and lung cancers. A recurrent rearrangement has been found between this gene and the transcription factor 7-like 2 (TCF7L2) gene in colorectal cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
• Protein Families: Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport