PGPEP1 (NM_017712) Human Mass Spec Standard

CAT#: PH314837

PGPEP1 MS Standard C13 and N15-labeled recombinant protein (NP_060182)

Product Images

Coomassie blue staining of purified PGPEP1 protein (Cat# TP314837). The protein was produced from HEK293T cells transfected with PGPEP1 cDNA clone (Cat# RC214837) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214837
• Predicted MW: 23 kDa
• Protein Sequence:
  Sequence Link

  >RC214837 representing NM_017712
  Red=Cloning site Green=Tags(s)
  
  MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLV
  VHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTI
  SQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060182
• RefSeq Size: 2239
• RefSeq ORF: 627
• Synonyms: PAP-I; Pcp; PGI; PGP; PGP-I; PGPI
• Locus ID: 54858
• UniProt ID: Q9NXJ5
• Cytogenetics: 19p13.11
• Summary: The gene encodes a cysteine protease and member of the peptidase C15 family of proteins. The encoded protein cleaves amino terminal pyroglutamate residues from protein substrates including thyrotropin-releasing hormone and other neuropeptides. Expression of this gene may be downregulated in colorectal cancer, while activity of the encoded protein may be negatively correlated with cancer progression in colorectal cancer patients. Activity of the encoded protease may also be altered in other disease states including in liver cirrhosis, which is associated with reduced protease activity, and in necrozoospermia, which is associated with elevated protease activity. [provided by RefSeq, Jul 2016]
• Protein Families: Druggable Genome, Protease