SPAG16 (NM_001025436) Human Mass Spec Standard

CAT#: PH315059

SPAG16 MS Standard C13 and N15-labeled recombinant protein (NP_001020607)

Product Images

Coomassie blue staining of purified SPAG16 protein (Cat# TP315059). The protein was produced from HEK293T cells transfected with SPAG16 cDNA clone (Cat# RC215059) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215059
• Predicted MW: 20.4 kDa
• Protein Sequence:
  Sequence Link

  >RC215059 representing NM_001025436
  Red=Cloning site Green=Tags(s)
  
  MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIP
  EGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKG
  VTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001020607
• RefSeq Size: 1296
• RefSeq ORF: 549
• Synonyms: PF20; WDR29
• Locus ID: 79582
• UniProt ID: Q8N0X2, Q4G1A2
• Cytogenetics: 2q34
• Summary: Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively (Zhang et al., 2007 [PubMed 17699735]). [supplied by OMIM, Jul 2008]