C1orf86 (FAAP20) (NM_182533) Human Mass Spec Standard

CAT#: PH315561

C1orf86 MS Standard C13 and N15-labeled recombinant protein (NP_872339)

Product Images

Coomassie blue staining of purified FAAP20 protein (Cat# TP315561). The protein was produced from HEK293T cells transfected with FAAP20 cDNA clone (Cat# RC215561) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215561
• Predicted MW: 19.6 kDa
• Protein Sequence:
  Sequence Link

  >RC215561 representing NM_182533
  Red=Cloning site Green=Tags(s)
  
  MEAARRPRLGLSRRRPPPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSLPAFPGQEPRC
  GPEPTEVFTVGPKTFSWTPFPPDLWGPGRSYRLLHGAGGHLESPARSLPQRPAPDPCRAPRVEQQPSVEG
  AAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_872339
• RefSeq Size: 745
• RefSeq ORF: 540
• Synonyms: C1orf86; FP7162
• Locus ID: 199990
• UniProt ID: Q6NZ36
• Cytogenetics: 1p36.33