SUNC1 (SUN3) (NM_001030019) Human Mass Spec Standard
CAT#: PH315649
SUN3 MS Standard C13 and N15-labeled recombinant protein (NP_001025190)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215649 |
Predicted MW | 40.3 kDa |
Protein Sequence |
>RC215649 representing NM_001030019
Red=Cloning site Green=Tags(s) MSGKTKARRAAMFFRRCSEDASGSASGNALLSEDENPDANGVTRSWKIILSTMLTLTFLLVGLLNHQWLK ETDVPQKSRQLYAIIAEYGSRLYKYQARLRMPKEQLELLKKESQNLENNFRQILFLIEQIDVLKALLRDM KDGMDNNHNWNTHGDPVEDPDHTEEVSNLVNYVLKKLREDQVEMADYALKSAGASIIEAGTSESYKNNKA KLYWHGIGFLNHEMPPDIILQPDVYPGKCWAFPGSQGHTLIKLATKIIPTAVTMEHISEKVSPSGNISSA PKEFSVYGITKKCEGEEIFLGQFIYNKTGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTCLYRFRVH GTPGKHI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001025190 |
RefSeq Size | 1452 |
RefSeq ORF | 1071 |
Synonyms | SUNC1 |
Locus ID | 256979 |
UniProt ID | Q8TAQ9 |
Cytogenetics | 7p12.3 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407274 | SUN3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422237 | SUN3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425510 | SUN3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407274 | Transient overexpression lysate of Sad1 and UNC84 domain containing 3 (SUN3), transcript variant 2 |
USD 396.00 |
|
LY422237 | Transient overexpression lysate of Sad1 and UNC84 domain containing 3 (SUN3), transcript variant 1 |
USD 396.00 |
|
LY425510 | Transient overexpression lysate of Sad1 and UNC84 domain containing 3 (SUN3), transcript variant 1 |
USD 396.00 |
|
PH306129 | SUN3 MS Standard C13 and N15-labeled recombinant protein (NP_689995) |
USD 2,055.00 |
|
TP306129 | Recombinant protein of human Sad1 and UNC84 domain containing 1 (SUNC1), transcript variant 2 |
USD 823.00 |
|
TP315649 | Recombinant protein of human Sad1 and UNC84 domain containing 1 (SUNC1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review