MBNL3 (NM_018388) Human Mass Spec Standard

CAT#: PH316043

MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_060858)

Product Images

Coomassie blue staining of purified MBNL3 protein (Cat# TP316043). The protein was produced from HEK293T cells transfected with MBNL3 cDNA clone (Cat# RC216043) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216043
• Predicted MW: 38.4 kDa
• Protein Sequence:
  Sequence Link

  >RC216043 representing NM_018388
  Red=Cloning site Green=Tags(s)
  
  MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYL
  HPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGM
  GLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASD
  NTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGAT
  PVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGN
  QLKF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060858
• RefSeq Size: 2701
• RefSeq ORF: 1062
• Synonyms: CHCR; MBLX; MBLX39; MBXL
• Locus ID: 55796
• UniProt ID: Q9NUK0
• Cytogenetics: Xq26.2
• Summary: This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009]