MBNL3 (NM_133486) Human Mass Spec Standard
CAT#: PH316093
MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_597846)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216093 |
Predicted MW | 36.2 kDa |
Protein Sequence |
>RC216093 representing NM_133486
Red=Cloning site Green=Tags(s) MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYL HPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGM GLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASD NTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALTNLQLPQPAFIPAGPILCMAP ASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQIPQLSIDELNSSMFVSQM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_597846 |
RefSeq Size | 1575 |
RefSeq ORF | 1002 |
Synonyms | CHCR; MBLX; MBLX39; MBXL |
Locus ID | 55796 |
UniProt ID | Q9NUK0 |
Cytogenetics | Xq26.2 |
Summary | This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408817 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC413087 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432842 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432854 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408817 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 2 |
USD 396.00 |
|
LY413087 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 1 |
USD 396.00 |
|
LY432842 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4 |
USD 396.00 |
|
LY432854 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3 |
USD 396.00 |
|
PH316043 | MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_060858) |
USD 2,055.00 |
|
TP316043 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant G |
USD 748.00 |
|
TP316093 | Recombinant protein of human muscleblind-like 3 (Drosophila) (MBNL3), transcript variant R |
USD 748.00 |
|
TP329842 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4. |
USD 823.00 |
|
TP329854 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review