NCF4 (NM_000631) Human Mass Spec Standard
CAT#: PH316094
NCF4 MS Standard C13 and N15-labeled recombinant protein (NP_000622)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216094 |
Predicted MW | 38.9 kDa |
Protein Sequence |
>RC216094 representing NM_000631
Red=Cloning site Green=Tags(s) MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLE ERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDS EQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEG TVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000622 |
RefSeq Size | 1386 |
RefSeq ORF | 1017 |
Synonyms | CGD3; NCF; P40PHOX; SH3PXD4 |
Locus ID | 4689 |
UniProt ID | Q15080 |
Cytogenetics | 22q12.3 |
Summary | 'The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]' |
Protein Pathways | Leukocyte transendothelial migration |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402260 | NCF4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424600 | NCF4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402260 | Transient overexpression lysate of neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2 |
USD 396.00 |
|
LY424600 | Transient overexpression lysate of neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1 |
USD 396.00 |
|
TP316094 | Recombinant protein of human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1 |
USD 748.00 |
|
TP760264 | Recombinant protein of human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
TP760667 | Purified recombinant protein of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review