SNX16 (NM_022133) Human Mass Spec Standard
CAT#: PH316565
SNX16 MS Standard C13 and N15-labeled recombinant protein (NP_071416)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216565 |
Predicted MW | 39.2 kDa |
Protein Sequence |
>RC216565 protein sequence
Red=Cloning site Green=Tags(s) MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSS PLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWV VFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREF LCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPE ESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_071416 |
RefSeq Size | 3471 |
RefSeq ORF | 1032 |
Synonyms | DKFZp666H147 |
Locus ID | 64089 |
UniProt ID | P57768 |
Cytogenetics | 8q21.13 |
Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The protein encoded by this gene associates with late endosome membranes as is involved in tubule formation, cholesterol transport, and transport of tetraspanin CD81. The encoded protein also inhibits cell migration and tumorigenesis. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403494 | SNX16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC411753 | SNX16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403494 | Transient overexpression lysate of sorting nexin 16 (SNX16), transcript variant 2 |
USD 396.00 |
|
LY411753 | Transient overexpression lysate of sorting nexin 16 (SNX16), transcript variant 1 |
USD 396.00 |
|
PH307476 | SNX16 MS Standard C13 and N15-labeled recombinant protein (NP_690049) |
USD 2,055.00 |
|
TP307476 | Recombinant protein of human sorting nexin 16 (SNX16), transcript variant 2 |
USD 823.00 |
|
TP316565 | Recombinant protein of human sorting nexin 16 (SNX16), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review