Apolipoprotein L 2 (APOL2) (NM_145637) Human Mass Spec Standard
CAT#: PH316858
APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_663612)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216858 |
Predicted MW | 37.1 kDa |
Protein Sequence |
>RC216858 protein sequence
Red=Cloning site Green=Tags(s) MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNR HDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPF TEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVGGNTPNVLTLV DNWYQVTQGIGRNIRAIRRARANPQLGAYAPPPHVIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATG GILLLLDVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_663612 |
RefSeq Size | 2686 |
RefSeq ORF | 1011 |
Synonyms | APOL-II; APOL3 |
Locus ID | 23780 |
UniProt ID | Q9BQE5, A0A024R1M8 |
Cytogenetics | 22q12.3 |
Summary | This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403087 | APOL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407937 | APOL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403087 | Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant alpha |
USD 396.00 |
|
LY407937 | Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant beta |
USD 396.00 |
|
PH302585 | APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_112092) |
USD 2,055.00 |
|
TP302585 | Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant alpha |
USD 823.00 |
|
TP316858 | Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant beta |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review