MID1IP1 (NM_001098790) Human Mass Spec Standard
CAT#: PH317566
MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092260)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217566 |
Predicted MW | 20.2 kDa |
Protein Sequence |
>RC217566 protein sequence
Red=Cloning site Green=Tags(s) MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPV PDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001092260 |
RefSeq Size | 2020 |
RefSeq ORF | 549 |
Synonyms | G12-like; MIG12; S14R; STRAIT11499; THRSPL |
Locus ID | 58526 |
UniProt ID | Q9NPA3 |
Cytogenetics | Xp11.4 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400445 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC411994 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420677 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426044 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429650 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400445 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3 |
USD 396.00 |
|
LY411994 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1 |
USD 396.00 |
|
LY420677 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2 |
USD 396.00 |
|
LY426044 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2 |
USD 396.00 |
|
LY429650 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1 |
USD 396.00 |
|
PH303444 | MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_067065) |
USD 2,055.00 |
|
PH321845 | MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092261) |
USD 2,055.00 |
|
TP303444 | Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1 |
USD 823.00 |
|
TP317566 | Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2 |
USD 748.00 |
|
TP321845 | Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review