PKI alpha (PKIA) (NM_006823) Human Mass Spec Standard

CAT#: PH318237

PKIA MS Standard C13 and N15-labeled recombinant protein (NP_006814)

Product Images

Coomassie blue staining of purified PKIA protein (Cat# TP318237). The protein was produced from HEK293T cells transfected with PKIA cDNA clone (Cat# RC218237) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218237
• Predicted MW: 8 kDa
• Protein Sequence:
  Sequence Link

  >RC218237 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGE
  AAKSES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006814
• RefSeq Size: 4215
• RefSeq ORF: 228
• Synonyms: PRKACN1
• Locus ID: 5569
• UniProt ID: P61925, A0A024R7Y9
• Cytogenetics: 8q21.13
• Summary: The protein encoded by this gene is a member of the cAMP-dependent protein kinase (PKA) inhibitor family. This protein was demonstrated to interact with and inhibit the activities of both C alpha and C beta catalytic subunits of the PKA. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome