CHIT1 (NM_003465) Human Mass Spec Standard
CAT#: PH319169
CHIT1 MS Standard C13 and N15-labeled recombinant protein (NP_003456)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219169 |
Predicted MW | 51.5 kDa |
Protein Sequence |
>RC219169 representing NM_003465
Red=Cloning site Green=Tags(s) MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTE WNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWE YPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLM AYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTR VGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQK GLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFC QGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003456 |
RefSeq Size | 1633 |
RefSeq ORF | 1398 |
Synonyms | CHI3; CHIT; CHITD |
Locus ID | 1118 |
UniProt ID | Q13231 |
Cytogenetics | 1q32.1 |
Summary | 'Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to activated macrophages in culture. Human macrophages can synthesize a functional chitotriosidase, a highly conserved enzyme with a strongly regulated expression. This enzyme may play a role in the degradation of chitin-containing pathogens. Several alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2012]' |
Protein Families | Secreted Protein, Transmembrane |
Protein Pathways | Amino sugar and nucleotide sugar metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401172 | CHIT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY401172 | Transient overexpression lysate of chitinase 1 (chitotriosidase) (CHIT1) |
USD 605.00 |
|
TP319169 | Recombinant protein of human chitinase 1 (chitotriosidase) (CHIT1) |
USD 867.00 |
|
TP720378 | Recombinant protein of human chitinase 1 (chitotriosidase) (CHIT1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review