EED (NM_003797) Human Mass Spec Standard
CAT#: PH319261
EED MS Standard C13 and N15-labeled recombinant protein (NP_003788)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219261 |
Predicted MW | 50 kDa |
Protein Sequence |
>RC219261 representing NM_003797
Red=Cloning site Green=Tags(s) MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGK GKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVD ADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVS KDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDY NPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNV TILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSR DSSILIAVCDDASIWRWDRLR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003788 |
RefSeq Size | 2006 |
RefSeq ORF | 1323 |
Synonyms | COGIS; HEED; WAIT1 |
Locus ID | 8726 |
UniProt ID | O75530 |
Cytogenetics | 11q14.2 |
Summary | This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhancer of zeste 2, the cytoplasmic tail of integrin beta7, immunodeficiency virus type 1 (HIV-1) MA protein, and histone deacetylase proteins. This protein mediates repression of gene activity through histone deacetylation, and may act as a specific regulator of integrin function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401248 | EED HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC407233 | EED HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401248 | Transient overexpression lysate of embryonic ectoderm development (EED), transcript variant 1 |
USD 605.00 |
|
LY407233 | Transient overexpression lysate of embryonic ectoderm development (EED), transcript variant 2 |
USD 396.00 |
|
PH324366 | EED MS Standard C13 and N15-labeled recombinant protein (NP_694536) |
USD 2,055.00 |
|
TP319261 | Recombinant protein of human embryonic ectoderm development (EED), transcript variant 1 |
USD 788.00 |
|
TP324366 | Recombinant protein of human embryonic ectoderm development (EED), transcript variant 2 |
USD 748.00 |
|
TP760652 | Purified recombinant protein of Human embryonic ectoderm development (EED), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
TP761504 | Purified recombinant protein of Human embryonic ectoderm development (EED), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review